SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA18119 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA18119
Domain Number 1 Region: 109-223
Classification Level Classification E-value
Superfamily Second domain of FERM 6.41e-24
Family Second domain of FERM 0.00021
Further Details:      
 
Domain Number 2 Region: 222-319
Classification Level Classification E-value
Superfamily PH domain-like 4e-22
Family Third domain of FERM 0.00049
Further Details:      
 
Domain Number 3 Region: 34-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.21e-16
Family First domain of FERM 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA18119   Protein: JA33016   Gene: WBGene00137323
Sequence length 3515
Comment JA33016 WBGene00137323 locus:Cjp-frm-1 status:Predicted
Sequence
MGKDREPVDQQHHPPPATSPAPSQHPRDPKLQAARVRLPDGVYKEFEVNRGSEGEALFRQ
VTSDLSIEEREYFSLCFYDKEEGIRHWLYNDKKILKQLKNLPWEFSFEVKFYPTTPTTIV
DDHARYYVFLQLRRDILTGRLPATADTHALLGSFVAQIEFGDAPAQVNDEYEKFIVGARL
VPTEHSNAEVYKTIAELHRELRGQTASEAEILFLDHCKHLALYGIHLFKAIDKDKKPVDI
GVGAAGVNIYQDEQKVHSFNWQNIIKIGYKRSYFSVKLKAGTVGKDEKTLYYKLPTHLTS
KRAWKCAVEHHTFFRYCNLYFKHYFWWFQVDSTRGQAEQVVLQFWIPTLPLPGTHTVPNE
DGVANVRQADERRSGAVRHQHRLNTLNLTDSELEQRTFERYRRALTPKSYTRGADDDDAS
LSATFAKYSSSRPSTLLIVNTNSNTPDRQNQHDLSYSPRGHDDSNLSSAAYYLSERSSLR
TPSSAYYPPSEFSSSQIQSPTSPHSFEEQNRGEYYVQMRPSGSGARRNLFGRASASDRTS
TNSVRLVSFHEPIDPDQPIPNTYPVNELPEIPIERIVHVYHEGHYDRLSPRREQRQQLPY
GFGNYTPRNGVSHVDRLEPHGEMEQQPIRFYVDVRHSGVSRRDPAKRLSHPGKEDIKEQI
DPKDYEFASVSSKDPLHRTELSRDVQPANIQQYTRKYHHGDSQKISEQPVAPQYRLITHV
QPLVVSHRDSRNGQSSSNVNATISQREQVVSTKVRRESPDADRRVRLSASVDRSGNVTEI
SDEMATSSDVVTTTTSTSTTVIETAPKRTKKQKIPPTSFSEKLESQTVTSSSTSSTPVQS
DRSRFGGFFGKKSAKTSGYPTTSEQYSGEINAIERNNDLENAPFERQTTLPQATTTTITY
RLISRIRHDGDEDIVENPNAYAFDSTIYGGDLDEIARGYEIEQSPLEQHSTVYHHGESWR
VDKPKSPTHKVNKDVQKKTEALKKAKAVESAEPEEKNIRLIARVRKESEQRPEKEKKPKK
ESSKFGFFSRTTKTTKTTGYPSASEQFSGELSTTDRTHEFESSPFEKHGIHVHTPHKRNI
SESSVAIDEPDQPEKKRYRLISRFRHEGNEDIVENPEAYGFASTSYNGPLDEIRIQDELE
HHDIAGHSTVYHHGESWRIEKTTSPVGKKVKSLKKETVIVEPLVEAEKRETRLITRVRTE
EEQTSGPIKEKKKKESSKSKLPTIGIFNRKTPKSSQYPETTEQFSGELDFTDRTRDLESS
PFNHPEYPEYSPKKSDAYQPAKPVSPVEKKIRLIARFRHDGEEDEVEKAHIRPEAYGFAS
TSYDGPLEETNLERDLEHSKLGDYSSVYHPGESWKIQEKQVTEKKEKAAKKVHQEKHDVR
LIARVVSDEGEPEDVKSSVVEKPKSKKRFFKSSSEYPEKTDRYTGELDTIDCSHDLKNVP
LVHPEVQIHDTRVISEIDPAVTHEKKRYRLLARFRHEGDEDVVEKPDAYGFDSRLYEGPL
DETALGKEVDQTPIGEHSTVYHHGESWRVEAPITQGVKQKKAKTEKTLETVESEKKEVRL
IARVQTKPEDEPTAVSGKEKKSKKEKSKSKLPIFNQSRKETNYPEKSEEFIGEIGSINRT
DEMDSEPFEHTDYPQYSPKKLVISETSNVPTTEGEKRRYRLIARFRHDGDEDVIEKPDTY
EFASTIYDGPLENIQPAGELDQAPIADHSRVYHHGESWRIEKPVSPVPSDHEKTKKVKIL
KTKKAEEPVEPEAKEIRLIARVKADETEDSVPEKVSKEKKPKTEGSRFGFFTRTTKTTKT
SGYPSTSEHFTGELDTTDRIRDLESSPFEHPDYPEYSPTQKVLAEEPQDVPVSHSEKKRY
RLIARFRHEGDEDEVEKPDPYAFASTVYDGPLDDIRPKGELDQTPIADHSNVYHHGESWR
IEKPVSPVPSDHEKTKKVKTLKTKKAEEPAEPEAKEIRLIARVKADETEDSVPEKVSKEK
KPKTEGSRFGFFTRTTKTTKTSGYPSTSEHFTGELDTTDRIHDLESSPFEHPDYPEYAPT
QKLTVQKPEEVSVSQPEKKRYRLIARFRHEGDEDEVEKPDAYAFASTVYDGPLDDIRPEG
ELDQTPIADHSNVYHHGESWRIEKPVSPVPSDHEKTKKVKALKPKKAEEPVEPESKEIRL
IARVKADEPENSVSEEVSKDKKPKTEGSRFGFFTRTTKTTNTSEYPSVSEHFIGELDTTD
RIHDLESSPFEHPDYPEYSPTQKVLAEEPQDVPVSQPEKKRYRLIARFRHEGDEDEVEKP
DAYAFASTVYDGPLDDIRPEGELDQTPIADHSTVYHHGESWRIEKPVSPVPAHDEKTKKA
KTLKTKKAEEPVEPESKEIRLIARVKADEPEDSVHEKVSKEKKPKTEGSRFGFFTRTTKT
TKTSGYPSTSEHFTGELDTTDRIHDLESSPFEHPDYPEYSLKQKITMEEPQDVPVSQPEK
KRYRLIARFRHEGEEDEVEKPDAYAFASTVYDGPLDDIHPEGELDQTPIFDHSNVYHHGE
SWRIEKSVGSPSTLEKKSKKIDTKKEKKDKPVKTTPLVEEEPKEVRLIARVLPQEPIVEE
TTINGTAEPSAARSEPRNRTPFFKFGRKTPTKNVSAYPETSPAYDGPLEVVSKGEDLEKT
EFEREEHPSYFAKNDADQTLQASVPRQEKPRYRLIARYRHEGDEDEVEKPNTYDFASNVF
DGPLDDIRPVKELDQAPISDHSAIYHSGDSWRVEKSVPSVSTLEKKIKKVISPKKEKIET
PVEPEKHEVRLLARVKVEEPEDVISEKINKKKKPTKKETIGYRETSEQFIGELDTTQRSE
DLENVPFEHREVPAYSPKKVGRENTPQESAVLAEKKRYRLIARFRHDGDEDEVEKPEFYG
FPPEAYSGILEEISSYPELEQTPIKEHSSVYHHGESWRIQKPASPVSSEEKPKKFKAPKA
ENFGEPVQPETKEVRLIARVPAYEPEKELTSEPKKEKTPEKPKFKFGFFNKSNKSSGYPS
TSQLYTGEVDTTGRSNDLEPIQFEHPEYPTYSPKNVFSAEKTKVSVPEIEKKRYRLVARV
RHDGEEDVVEKPNVYSFASTAYEGPLDDIRPVGEVNQTPLADHSTVYHHGESWRVVKPTT
PVAPPKKAKIDKKGRAELKRRETPYMGYPLPSGHYVGDLESTVRTPDLDSIPFEYEQPNS
PANILAEPVQKRYRLIARFRHEGEEDEVEKPDAYAFASTVYDGPLDDIRPEGELDQSPIS
DHSNVYHHGESWRIEKPVSPVPSDHEKTKKVKELKKRKIAEPAEPEAKEIRLIARVKVDE
PEDTVPEKLTKEKKPKTDGSRFGFFTRTTKTTKTTGYPSTSEVFTGELDTTNRIHDLESS
PFEHPGYPEYSPVQKVAVQKSQDVSSVQPEKKRYRLIARFRHEGDEDEVEKPDAYAFAST
AYDGPLDDIRPEGELDQTPIADHSTVYHHGESWRIEKPVSPVPSDHEKTKKVKAFKPKKA
XXXXXXXXXXXXXXXXXXLLPRRRPPKTSGLSVNI
Download sequence
Identical sequences CJA18119 281687.CJA18119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]