SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA18201 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA18201
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.52e-52
Family Reverse transcriptase 0.00077
Further Details:      
 
Domain Number 2 Region: 373-527
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.81e-39
Family Retroviral integrase, catalytic domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA18201   Protein: JA31402   Gene: WBGene00137405
Sequence length 734
Comment JA31402 WBGene00137405 status:Predicted
Sequence
MPVPKDLKAVLRFVGMAGFFRKFIKNFSEIAEPLTKLNKKEQPFEWTVEQQQAFDKLKEL
LTSKPILIYPDYEREFHIFTDASAVAQGAMLAQTTEDLDRFHVVAYASRTLSEIETRRPA
IQIELGAIIFALRHFKPYVCLSKIILHTDHRPLVYLLAKRKVNERLARWLIELQQYDISI
VHIDGKKNTVADCLSRAKDEVAPLPDEELEDVIEFPVCMAIDRANDRVSKHFTPVGTRKP
INIASEQNEDEDIRIITTFLTSPAASIEGISEEWTPFLERVSLSDKGILTVKFGGESTKV
VIPKKLRKLVWESFHSSLLGGGHFNWRKSLHKAQKKYFWPGMRSEFLKWTLECIKCQQKQ
NPHPSKRELQQVVITSHVFETVGVDLTGPLRTSTKGNKYYINMICWFSKFVVSVPLPDAT
CESIARAILEELVLKFGTPNQIVSDNATSFTSAAFKQFCELLDISHHRAIPYHSKGNGAT
ERTFRTFHSMIAKHVNKSHTDWDTLLPYVTFNYNNTVHSTTGETPFFLIFGRDPTLTIDR
ILDPSPKSVKTDLRLFKESLTTTLRDAWNEAAIRSREAQAVYQKKANEGAQGSIIKAGDR
VMYKDYSNHKGLSRKLVLPWTGDFRVVEVNPPTATIYDRRDSRKPERIVHLDQIKKISSS
EEDIDTPVTEADAVANDGTNSEVGDKQEEVIRNPEPTVQTTSKTLSNQTETSPDIAPVRR
NPQRQRKLPAKFKT
Download sequence
Identical sequences 281687.CJA18201 CJA18201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]