SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA19004 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA19004
Domain Number 1 Region: 509-699
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.56e-56
Family Reverse transcriptase 0.0014
Further Details:      
 
Domain Number 2 Region: 278-380
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000488
Family Retroviral protease (retropepsin) 0.019
Further Details:      
 
Domain Number 3 Region: 136-178
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000011
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA19004   Protein: JA24370   Gene: WBGene00138208
Sequence length 700
Comment JA24370 WBGene00138208 locus:Cjp-dct-10 status:Predicted
Sequence
MKKKDIKSLKELQDELATVFDNDILSDHREEVLRNCKQAQDETVDQFYQRIESLENLINS
GKTNPETVQRIALQAFVNGLGWHIRFNVKNKRPRTMDAAFQEAIFQETLHKEQVGSQVFS
PLALAYLANYTNGAQTSGQDRQNRPQPDSTRFRGECFYCRKLEHFAKDCKKKQRDQGSRR
NVNYRPKDPVANHRQWTPKPAVQTNAVHTGMPTYEDLARRLETKDAQIEQLCAKLSEMQG
DDYESTFDSKVCSLTWPGSSNIPKQATQAAHGEYFTAHVPIRANNIPDSALIDTGANLTV
ASADTCKMLGIQQLQKSRAPHAIGLGGNAVKMAGAATVTFRIGSNTMDHVVHFTPGKCIP
EEGRPYSFIFGNDLLAKLPPFFINYKEAVFHVGDDVLPMGRKVGNMKLTRNFQVQVCSDT
VIPAGTEALVKCSISPIPKKEENLVLMVDSQLLTKEDLFVSPAVFDSKNVLLRIGNPTIE
DKQLNANQTAASAERITSQGIQKAELQALLDEFADTFSKNAYDLGSSKTEPVHIYTTTET
PVRGRSYRVPVKFQAELQKHINSLLWSERITESNTPWTSPIVLVKKKNGSMRVCLDFRKL
NEVTIPDNYPLPRIDSIIEQVGGAKFFSSLDMANGYLQLRLDRQSSYKCGFITENKVYAY
THLPFGLKSAASYFQRALKTVLSGLEKEVLVYIDDVLVHX
Download sequence
Identical sequences CJA19004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]