SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA19102 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA19102
Domain Number 1 Region: 1041-1108,1151-1292
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000317
Family DNA polymerase I 0.015
Further Details:      
 
Weak hits

Sequence:  CJA19102
Domain Number - Region: 623-672,713-742
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000364
Family DnaQ-like 3'-5' exonuclease 0.035
Further Details:      
 
Domain Number - Region: 184-212
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.068
Family H-NOX domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA19102   Protein: JA27021   Gene: WBGene00138307
Sequence length 1345
Comment JA27021 WBGene00138307 status:Predicted
Sequence
MSDKNILPNIFYTIETNGLPFYNTLVRKNLTSFLKKKENLVLNDIFKDCDIRIMFHLECK
KLINTTSDTNKYDCTSFDFDITSEIQILHYGENRNTFFQNVVQQIINKVISSQENIENGV
ISKFVKLVMHQSKHSSASTSQKSEGYGQVYDEYSSYLVINETNHTEDAKTLVYQERSKFP
EERESKYLKTTFFNLVKSIDNIHHYLDVTYPREDKAIKFYIMFGYVTERNNEVNLFKPGR
NEYFFNKPVLMKNAEDLKSIKQKLTKESITMHLNSKSIVSLENVENNMCFFNCIALATGC
RTDRYTKKSKEIFEKFYEKSIKRGKRKYEEYVGFDFVNELDHFEEIYRGLAVNIVSFYPI
SEENEESISYIRKSKFNEERRPIYLNLYLDHFSYITDLKKLSKLYLCNRCGFKCRDNHNL
QRHIDTCQLEQIDVFPKYPKLWNKKRNLIVELSDYYDIDVDFRYDYLVVFDFEAIQSKNE
IIEEVKDLQDPEVVKDNKKLNYISKHTPVSVSITSNVPEFEKEKFILSENPRDLIKQMFK
CFDDISKKAGDLMIEKMSPLLDILEDAEDYNNLKLVEQYCSVVPIIGFNSGGYDINLAAD
QGFMSEIIERCKNPFIIKEGSNRYKVIKTNNFIFLDQMGYCAAGTTLEKLFKAYDVGEQK
GWFPYEWFDSYEKLDFPTKDLKIKDFYSSLKNKHMKEEDFTTLMKICNERRLTKVRDLLE
WYNNLDVRPLLKACLKQKEFFYTFNLDIEHILYQFQIQGFEEYLKQRSPKTYYTLSIYED
ILEKRIYNYYKQDKESNRSTDDILQVEDVVDILKRENYKCFYCWFCLKEDTWSLDRLDCS
KSHTKDNCVACCISCNKARSKKLFKEFYRHKALLRWEKDHPMIWLFGEENKEAFYKFKNN
ITGGASIVFHRYHEKDKTQITRVHYDQDKKEWYYDKEGNCLGEEMPCGKLYFEEKNDFSF
YEKSLMSNTSPFFGFLEVDIEVPEDKWEYFGELSPIFVNKEYDESICGEYTNKVIKSLDR
KPSKSKKLVTILKAEKILIKSTRLRWMLEHGCIVTKLHGVIEAKGGRVFKDFMNWVSDER
RKGDVDQKYAIISEGAKLVGNSAFGVTGMDKNKHRKVKMCDEIQFNRAKNDYFYYDAEEY
DGTYEVVKKSKKVKQNIPIQIACSVYDDSKLRMLQFNYDCIDYFIPREDYQRLEMDTDSS
YMALAADFESLIKPHLRKEFEENKYKFFPRDDEKFKAFDKRTPGLFKVEFEGDGMIALNS
KTYFVWNEHENKMSAKGVQKGRNSDILVKEKYLACLMNNELIIGENKGFRFIDKSMKTYE
LNKTGLSPVYPKGVVMDDEIIPLPF
Download sequence
Identical sequences 281687.CJA19102 CJA19102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]