SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA19402 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA19402
Domain Number 1 Region: 909-1342
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.34e-135
Family Reverse transcriptase 0.0000459
Further Details:      
 
Domain Number 2 Region: 256-594
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.34e-103
Family Reverse transcriptase 0.0000963
Further Details:      
 
Domain Number 3 Region: 17-117
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000105
Family Retroviral protease (retropepsin) 0.016
Further Details:      
 
Domain Number 4 Region: 629-685
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000341
Family Retroviral integrase, catalytic domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA19402   Protein: JA32098   Gene: WBGene00138606
Sequence length 1637
Comment JA32098 WBGene00138606 status:Predicted
Sequence
MDRVNSARLPSAPLTTQIPVRINGFPVFALVDTGSTITVAGRAFATLGIPSLYQASASHA
VGLGGNEVFMAGAAFAKICIGTKSWIHRIHFTTGECTPHGARDYHIILGNDFLSQLPRFF
IDYQAETLHVGEEIIPIGKNHVEYTPKVLDIRVSEDTIVPAQSERVLACQEPMSTDMCDT
LFLVTSQNLVNRSLLTAPVLINNKNVRILVTNPTDCDIFLAKNTKAAEAVEEDPKFRISL
DKAVCTEAQKHVLLNLFAEFHDVFSKNAYDLGSSKTDPVHIYTNTEIPVRGRPYRVPVKY
QAELQKHINGLLLSERITESNTPWISPIVLVPKKNGSLRVCLDFRKLNEVTVPDNFPLPR
IDSIIEKVGGSKYFSSLDMANGYLQLRLDDESSYKCGFTTEDKVYAYTHLPFGLKSAASY
FQRALRTVLAGLEKDVLVYIDDVLVFSKTFESHVQTLKKVLSRFRAYNLKASPAKCEFVK
KSITFLGHEINECNYSPNEANLHTIKQIPVPTDAKGVLRFLGMAGFFRKFVKNFSNIAEP
LTRLNKKDVPFEWTSQQQEAFDTLKQLLATKQKIHERVARWLIELQQFDIEIKHIEGKRN
TVADCLSRAKDEGNSASQLGETELRRGRFGTFHSIIAKHVNNTHTDWDSVLQFATFCYNT
TVHKTTGETPFFLVFGRDPTLTIDRIIDPAPKSCKTDIPLFKESLVTVLQEAWEEAAVRS
RKAQEEYQKVANQGAKGSEIRPGDRVMYRDYSNHKGHSRKLTLPWTGNYRVISVNHPLAT
IREVKNHGKPARTVHLDQIKKFWATEEEDARSTSTQSDAEEPTEDSDVDVTTEDPTPISP
TVSDVPINHSDTTTIFLAMPKRPKESTQPPAKHNREGPAEDEEAEDPKFRISLDKAVCTE
AQKHVLLNLFAEFHDVFSKNAYDLGSSKTDPVHIYTNTEIPVRGRPYRVPVKYQAELQKH
INGLLLSERITESNTPWISPIVLVPKKNGSLRVCLDFRKLNEVTVPDNFPLPRIDPITEK
VGGSKYFSSLDMANGYLQLRLDDESSYKCGFTTEDKVYAYTHLPFGLKSAASYFQRALRT
VLAGLEKDVLVYIDDVLVFSKTFESHVQTLKKVLSRFRAYNLKASPAKCEFVKKSITFLG
HEINECNYSPNEANLHTIKQLPVPTDAKGVLRFLGMAGFFRKFIKNFSNIAEPLTRLNKK
DVPFEWTSQQQEAFDTLKQLLASKPILTFPNYDKEFHIFTDASAVAQGAMLAQTTDDPNQ
FQAIAYASRTLSDTETRYPAIQIELGAIIFALRHFKPYVYMSKIILHTDHRPLKYILAKQ
KVHERVARWLIELQQFDIEIKHIDGKRNTVADCLSRAKDEVAPRPEEELQDIVEFPVCMA
VKNSKDRVSSRFTQAGTQNYKSQRYDEKFLPMPKRPKESIQPPAKHNRDGPVEDEEAVRR
KFGCPRFGGTSTAGCGGRSQWIPPRSIRVAKTTVSAPSAPIWISKYLSSKQIAHFAQHKA
VRSLQAGDTSLTWEIPDGTQSPTLVWTLFDHRALSHTGPDYAQQPAARTIDDRRRPSDVR
RLLDTHTLPPTNQDRAADQSALMETFWKDPAHFLALYKAAISPISSVVSDPGPGPNCVLS
PLFHLVSPKDLYLFVIP
Download sequence
Identical sequences CJA19402 281687.CJA19402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]