SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA19574 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA19574
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000000999
Family Retroviral integrase, catalytic domain 0.015
Further Details:      
 
Weak hits

Sequence:  CJA19574
Domain Number - Region: 319-392
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0445
Family Reverse transcriptase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA19574   Protein: JA33474   Gene: WBGene00175145
Sequence length 561
Comment JA33474 WBGene00175145 status:Predicted
Sequence
MCESHGITHKTTATYCPRSNGAAERFADILKRGIAKIKGSASINQRVLNNFLISYRNTPH
AALNGATPAECHFSRKMLAERAFENTEWTHYQNEMKWAYDKRNGARANTFKVGQKVYARV
QHVNKWSWGYGKVRRRVGSSHLIGEHFWRGRKKCRPRVNNNWNRKYNRMCLVFNPKKNKI
LVVRDRSPTIRFQVPTATTRPSLLAXXXXHQISENSQSLTLRHSLVSQSLRRSQHNRRAP
FRYDPCSELQSHSEDRAPKRGSAPYADRAAAHSRGLHIASNCRLAPSQGRTKGNFVKGGR
GRPKRGVQPAYIALLQQSYTNCTTTITPFHKKIKIPITIGVRQGDPISPNLFSACLESVF
NKMTWQHLRGDDTGICGKVGLRMNTNKTKVMRNQFARQSPVNVTHNNATTCIEKVNEYVY
LGRLLNQNHELEPEFHRRRRASWAALKNIKSTTDALSCPRIRAQLFDSIVLPVRDPLLVI
KKKKLGWAGHIMGKNDGRWTRLGQEWYPIGEKRPVGKQRMRWSDSLKKEISLFDGEDLKT
HWSTIAKDGMAWNAVIRDNIT
Download sequence
Identical sequences CJA19574 281687.CJA19574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]