SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA20559 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA20559
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily EF-hand 6.16e-51
Family Calmodulin-like 0.000000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA20559   Protein: JA30725   Gene: WBGene00176131
Sequence length 191
Comment JA30725 WBGene00176131 locus:Cjp-ncs-1 status:Predicted
Sequence
MGKGNSKLKASHIRDLAEQTYFTEKEIRQWYKGFVRDCPNGMLTEAGFQKIYKQFFPQGD
PSDFASFVFKVFDENKDGAIEFHEFIRALSITSRGNLDEKLHWAFRLYDLDQDGFITRNE
MLSIVDSIYKMVGSSVTLPEEENTPEKRVDRIFRMMDKNNDAQLTLEEFKEGAKADPSIV
HALSLYEGLST
Download sequence
Identical sequences 281687.CJA20559 CJA20559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]