SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA20647 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA20647
Domain Number 1 Region: 77-122
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000179
Family Second domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA20647   Protein: JA20399   Gene: WBGene00176219
Sequence length 137
Comment JA20399 WBGene00176219 status:Predicted
Sequence
MNYHQLPSKIDFEADKLRITREQSAVPNISQNNSQQSALACTNPSCTSIPIFREQYKEYK
KDGDGNKNLPWEFSFEVKFYPTTPTTIVDDHARYYAFLQLRRDILTGRLPATADTHALHG
SFVVEMKIMCIKCYFFF
Download sequence
Identical sequences 281687.CJA20647 CJA20647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]