SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA21241 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA21241
Domain Number 1 Region: 28-74
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000589
Family Second domain of FERM 0.0022
Further Details:      
 
Domain Number 2 Region: 2-32
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000434
Family First domain of FERM 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA21241   Protein: JA23016   Gene: WBGene00176813
Sequence length 83
Comment JA23016 WBGene00176813 status:Predicted
Sequence
EGIRHWLYNDKKILKQLKNLPWEFSFEVKFYPTTPTTIVDDHARYYVFVQLRRDILTGRL
PATADTHALHGSFVVEMKIMFIY
Download sequence
Identical sequences CJA21241 281687.CJA21241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]