SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA21626 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA21626
Domain Number 1 Region: 40-85
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000275
Family Second domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA21626   Protein: JA22123   Gene: WBGene00177198
Sequence length 109
Comment JA22123 WBGene00177198 status:Predicted
Sequence
MASQLGIARSTVQSIVNNDLKLKVTNYVVDNLPWEFSFEVKFYPTTPTTIVDNHTRYYVF
LQLRRDILTGRLPATADTHALHGSFVVEKKEKRNEKQSESSSSPSMRSF
Download sequence
Identical sequences CJA21626 281687.CJA21626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]