SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA21737 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA21737
Domain Number 1 Region: 168-238
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.8e-21
Family GntR-like transcriptional regulators 0.01
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 2.13e-18
Family Cytokinin dehydrogenase 1 0.03
Further Details:      
 
Domain Number 3 Region: 484-595
Classification Level Classification E-value
Superfamily FAH 0.0000000000000183
Family FAH 0.0087
Further Details:      
 
Domain Number 4 Region: 253-302
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0000000759
Family GntR ligand-binding domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA21737   Protein: JA30862   Gene: WBGene00177309
Sequence length 603
Comment JA30862 WBGene00177309 status:Predicted
Sequence
MEEGLVADGVIATSRDQSRKLWLFREGMNEGQAKRGPHLRTDVSVPLSRLADFVRDAEAA
VYAGLPDCVCVSYGHVGDGNVHLNVLPPNTLDRAEIDARIYKAKNIINDVLDEAHARRTT
PIAIRNQACDRPYPCDEPRLPNELATLSRDEQLKGRNMSTDFGHIKRSEHLPARIATQIG
SDIHEGRLQPGDKLPTEHVLSKSFGVSRSVVREAIAQLRNEGLVDTRQGVGAFVTERQAR
SIRINEDELFSRDSFRDLFQLRFPLEIEAAGLAAAHHTADDLARLDEALEQMTGAAKWTD
QATTAPDWSDIIAALHFDGGCREEDSLTSKHSLSAHQILPDDAKNAILVGRVWSRVADGP
CPVLVRDERVLDLTAIAATVSSLFEIDGIAAKLASTTNLPDLGSLDDFLSGTTGHLLAPI
DLQAVKAAGVTFADSMLERVIEEQAKGDPSRARSIREKLAPVLGDSLRGVTAGSEKAASI
KTLLQDMNLWSQYLEVGIGPDAEIFTKAQPMSSVGCGDKVGIHPISEWNNPEPEVVLAVR
SDGEILGAALGNDVNLRDVEGRSALLLGKAKDNNASCSVGPFIRLFYDTFTLDVLSKVRV
SLL
Download sequence
Identical sequences CJA21737 281687.CJA21737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]