SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA22467 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA22467
Domain Number 1 Region: 2-35
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000135
Family Voltage-gated potassium channels 0.01
Further Details:      
 
Domain Number 2 Region: 37-66
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000703
Family Second domain of FERM 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA22467   Protein: JA28007   Gene: WBGene00178039
Sequence length 82
Comment JA28007 WBGene00178039 status:Predicted
Sequence
MAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLAKFYPTTPTTIVDDHARYYVFLQLR
RDILTFQPPPTLMPFTALLLLR
Download sequence
Identical sequences CJA22467 281687.CJA22467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]