SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA22632 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA22632
Domain Number 1 Region: 111-237
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.49e-21
Family GntR ligand-binding domain-like 0.022
Further Details:      
 
Domain Number 2 Region: 22-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-19
Family GntR-like transcriptional regulators 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA22632   Protein: JA19673   Gene: WBGene00178204
Sequence length 250
Comment JA19673 WBGene00178204 status:Predicted
Sequence
SRLNVVHDLLLDKSAGLGRNLERRTIRDVIADKISALIASGLLSIGDELPGERELATALS
VSRQTVRGAIQILAARGILEVAQGARTRVASIDLTGLSIGITSRLNVDLYDVHAVHAARL
LVEQQIVGDAAERISDDALELLHRSLDAQASCMDDPVRFLICDREFHVAIYRECGNPLLA
DIVTDLYTYMMEHRRRAMAQPGAVDGSFADHQVILSALEKRDRVAAMAAFAAHEERIYVS
TKKSLAAETR
Download sequence
Identical sequences CJA22632 281687.CJA22632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]