SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA22679 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA22679
Domain Number 1 Region: 477-696
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.45e-63
Family Reverse transcriptase 0.0016
Further Details:      
 
Domain Number 2 Region: 440-469
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000148
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA22679   Protein: JA37574   Gene: WBGene00178251
Sequence length 707
Comment JA37574 WBGene00178251 status:Predicted
Sequence
MAKTAWTTDKCLPRLTGSAAAALPSGEFCQGLGATDSSGIRAGAVGSMTPRHTRERSEFI
ITPTEHITTDVSNNAEEPSAAEQRGLISEERKSDSVTSNPVRGRQVRNVMNDVVQPSASE
QRTLNPEVRSEPGTTSTQSNSVVGHHVPHVNVANFKSNVTINAYSGAFSESLTNFVRQFK
DHTMAVDAGASEETKRYSFLTFLTGNARDRAEDFMTVNPEANVDEIIGDLKATFENELTG
QLREKQFSKCRQGRGEPIEAYYNRVRALASQAFRAEDRETIEKKTRDAFLDGLEDSIRYN
VKDKNPKTGRAAFDEALRQEILRDDRAAALQVRALASQAFRAEDRATIEKKTRDAFLDGL
EDSIRYNVKDKNPKTCRAAFDEALRQEILRDDRAAALQYPQSAAIFEEIRVLNEKWDNQN
TQRRKGPQRTQHRPEGTDNQWKPKFLGKCFYCGLSGHMARNCQKKLNASPATTNRRDEFH
DVFSKNAYDLGSSKTDPVHIYTSTEIPVRGRPYRVPVKYQAELQKHINGLLLSERITESN
TPWISPIVLVPKKNGSPRVCLDFRKLNEVTVPDNFPLPRIDSIVEKVGGSKYFSSLDMAN
GYLQLRLDEESSYKCGFTTEDKVYAYTHLSFGLKSAASYFQRALRTVLAGLEKDVLVYID
DVLIFSKTFECHVATLKKVLTRFRAYNLKASPAKXSSSAIFQTLLNP
Download sequence
Identical sequences CJA22679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]