SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA22681 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA22681
Domain Number 1 Region: 234-348
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.43e-34
Family GABA-aminotransferase-like 0.00032
Further Details:      
 
Domain Number 2 Region: 86-221
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.56e-20
Family GntR ligand-binding domain-like 0.02
Further Details:      
 
Domain Number 3 Region: 18-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000262
Family GntR-like transcriptional regulators 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA22681   Protein: JA24529   Gene: WBGene00178253
Sequence length 348
Comment JA24529 WBGene00178253 status:Predicted
Sequence
MTSNEMDAGEGEKHIPNLGDAAYKEMKERLIRGVYRPGYKMTVRAVAEDLDVSSTPARDA
LNRLISDGALVYAGPKTVIVPILTNNDLREITVIRIALEGLAAELGAPIATPTLIRNLIE
IQTLINNALEVNDYSAALWHNKEFHFLVYRLAGMPHLISMIEGLWLRIGPSLYNLYPEFA
EEKSGVRNHEMALEALNDRDGAALRAAFENDIRDGYRRLRRAAAGVSRSTIERDPIPAYA
FNGRGAYLTDADGNKYLDLNNNFTTLIHGHCFEPVTEAVAQILRSGTCFANPTEHELNLA
ELLIDRIPAVDRIRFVNSGTEAVMFAIKAARAFTGKPAIARFEGSYHG
Download sequence
Identical sequences 281687.CJA22681 CJA22681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]