SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA23015 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA23015
Domain Number 1 Region: 45-86
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000359
Family Second domain of FERM 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA23015   Protein: JA29178   Gene: WBGene00178587
Sequence length 192
Comment JA29178 WBGene00178587 status:Predicted
Sequence
MGEKKRENRRACSRAKKSRLKKRQSPLLRAKTNFTDLPWEFSFEVKFYPTTPTTIVDDHA
RYYVFLQLRRDILTGRLPATADTHALHGYFRRWMLCGVALLAHLLVFSIVDKKPVAHVAF
HENEVNEDWCLFLRYTCPLFTSSHGSYTPSFPIFAYVITNKLKVYHSCRLLISHFSPVVL
LLLASESVLVSV
Download sequence
Identical sequences 281687.CJA23015 CJA23015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]