SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA23045 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA23045
Domain Number 1 Region: 933-1171
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.15e-56
Family Reverse transcriptase 0.00033
Further Details:      
 
Domain Number 2 Region: 1313-1456
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.69e-39
Family Retroviral integrase, catalytic domain 0.0058
Further Details:      
 
Domain Number 3 Region: 771-861
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000525
Family Retroviral protease (retropepsin) 0.021
Further Details:      
 
Domain Number 4 Region: 456-522
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 0.00000575
Family Glycoprotein B-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA23045   Protein: JA31598   Gene: WBGene00178617
Sequence length 1477
Comment JA31598 WBGene00178617 status:Predicted
Sequence
MSSTLQICGFGLTGNLFVPPSPISCSFPSELQLQRHQIHIHMPRPEAVELEAFKCFKTKL
KAKKFGFLSIYQVTEMEVMKDTYVDVSVDECRNAILGKKYQNQNLEKISPGYYRTDSMAN
WTSTSYWFGSTEVDLFEFTVQKGIIATMDGSTIVSDLVVWETHSEKRECPYQYSSTTNAI
VNYDYIAVEELDIFSKIDKDLRKLHKIMDACFLNNALLTDDGILIEFPDQYHRRPQHTAL
WYRSKREVAYIMGEDGTQIALEIGQNFTTPLIWKLFGKTNIMDGPTIKQNIEDPILLKEF
KRFNVTKTILERCGRFYPEDRKHPKNYLIMALKAIRIAQYTWREKKRLAELPRELSPGER
TTKMLLEEGDTFLFDTLLAREFGESRQDLLNEDHEFPLPTFNETQMAKEPRMEPYTESSW
IAPPPPAAPMTKTTSAPQNIQAESTISTQDGFMSSCRNQYMATSLFETLLAIDPTAAVRQ
LLKRRDVSAKRVGDSLLVSKCRPVIPTTTHWSRKINNTCYELVPVTVDDVIWFQLPGSED
LVGEAATIPCIERTPIIHLEKTRWIGSENREVEPQRLVRPYRRTQTQYLLETPRTFYTTL
EEETGVSTGADKENERRYSRHQRDLENILQKDGILHEGWDLLRNTTRQLGNSAKEMYHST
VDSIESGARKIFFSLVDLLLWICIPLVGILLCIGCTYGYVKYLAFKKSTKLARRALGSTT
DALLGQLLHINQVQAQANAPPPPVKPKIHRTYEQEYPVVGVNAVNIKHEKTSQTPHIDVF
LQEGVLEALFDTGANVTYMRMRCVKGKIDTTKQSIARAANGGYIQFLGTITEEISIGDIH
IPHEIRVSLDNDCPADMLIGTXXXXRKRHLFSRQINGYATTRSSLGVKTTGLSTRNTGQL
QNLGHGRSFGGQSDPGGETTTYRNHRSTPEGFHQIKVMLEQRIIRPSTSPFSAPIVLVRK
ADKKSWRFTVDFRALNTKAVAEFPRPKTVKDVRAFLGMASFYRRFVENFSKIAIPLCELT
KKDVAFNWTMEREKAFQQLKDALISDQVLAAPKLGKPFVIEVDSSGLGVGAVLSQYQDKE
EKDLKVIVYASRTYNIHERNYVAIELEALGLVFAVHNFRPFIDGARTTVITDHSPLKALL
HRKDLTGRLARFQIAIQGYDIHIVYRPGKQNTVCDTFSRYHPEMVNTLNRLLNIDFAKIR
EKQTNDERILESRKFIRSHLVQNDIVFTKGEKDEWVIFLPHNSAYGQELAKMIHESIFEG
AHLGRDKTESRVRSIACWKGMTRAIQKVVEQCQVCQKTKDPIKNRIHAPLGKFETPSSPF
ERVHADYIGPLPETTQGNIYIAVFVDAFSKFIIAEPARNQTAESLCNIFKDRVVSRFGPR
KQLVTDRGTNFTSKKFKEVLETLNIDHSMSTAYHHEANGQVERANQTIEQMLRQCKDDEE
WDTELQTLLQAYNTAQNATTXXXXVRSIRLQTIQIEF
Download sequence
Identical sequences 281687.CJA23045 CJA23045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]