SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA23393 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA23393
Domain Number 1 Region: 90-219
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 9.68e-25
Family GntR ligand-binding domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 18-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.88e-18
Family GntR-like transcriptional regulators 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA23393   Protein: JA38380   Gene: WBGene00178965
Sequence length 239
Comment JA38380 WBGene00178965 status:Predicted
Sequence
MNFFGSNAPDTTENGNNNGAARWHSVYQGLRDAIVSHQLLPGTKLPEDELATIYSVSRAV
VRSALQALSHDRLARLEPNRGAFVAEPSREEAREVFEARTLVEPEVAALAAKVATAADIA
RLRKHLDDEHAALHAGRDSDAIRLSARFHLDLAEIAGHSILAGFVAELLPRSSLIIALYW
QRRETTCESHAHNALVDAIEQHKVEDAETLMKTHILDLLAGLNLDRMEKEQKRLSDILR
Download sequence
Identical sequences WP_051514714.1.22424 CJA23393 281687.CJA23393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]