SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA23472 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA23472
Domain Number 1 Region: 287-444
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.07e-41
Family Retroviral integrase, catalytic domain 0.0057
Further Details:      
 
Domain Number 2 Region: 4-89
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.11e-19
Family Reverse transcriptase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA23472   Protein: JA37090   Gene: WBGene00179044
Sequence length 602
Comment JA37090 WBGene00179044 status:Predicted
Sequence
MKAIELDEDSKNLLCINTHRGLFQFNRLPFGVKPATAIFQQVMDSMISGIEGAAAYLDDI
IISGGTVEEHNSRVKAVMQRIADYGFRIRIRARWATILLNYDFSIEYVNTHDFGQADALS
RLIAEQSQSKEVEDQVIGQVECEVIANLVSTCNSLPVTVDMISSASTKDAIIAEAINHVK
HNSWPNKMDHGSILWNFFNRREQLSIVKDCLMLGDRVVIPTALRHRVLKMLHRAHPGMVR
MKQLARSFVYWPSLDKDIESTVRSCDDCAAAAKDPIKNTLCSWPTPTAPWTRVHADYAGP
IEGTYYLVIVDSYSKWPEVIATKSITSTSTISIFRKVFAQFGNPKTLVTDNGTQFTSTQF
IDFCKEHGIQHIRSPPFHPQSNGQAERFVDTMKRALRKLQGEGNADTAIQVFLQNYRSTP
CEASPHYLSPAENFIGRKIRTTLDLLLPSSESPTARNDSMEAQFNRHHGARERMFQEHDK
VYVKDFRNPQNATWISGVVQKRIGRTLYKVLVNGSVWKRHTNQLRRRDIAPFAGSTDIWY
LDVVTPSRADNSNQLPSTIQPTPASPTSPRLIAPTQPTIRTSTRHRNPVKKLDIDPRTKS
YK
Download sequence
Identical sequences CJA23472 281687.CJA23472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]