SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA23787 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA23787
Domain Number 1 Region: 1-307
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.45e-88
Family Reverse transcriptase 0.00039
Further Details:      
 
Domain Number 2 Region: 482-596
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.9e-37
Family Retroviral integrase, catalytic domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA23787   Protein: JA21569   Gene: WBGene00179359
Sequence length 643
Comment JA21569 WBGene00179359 status:Predicted
Sequence
IELDEDSKNLMCINTHRGLFQFNRLPFGVKPATAIFQQVMDSMISGIEGAAAYLDDIIIS
GGTVEEHNSRVKAVMQRIADYGFRIRIEKCKFLMKQIVFLGFVIDEHGRRPDPEKVADIQ
KMPAPTNVSQLRSFLGLIQFYGAFVKELFELRPPLNELTKKYQEFIWSPKCQKAFERIKE
ILQSDLLLTHFDPKLPIIVAADASQYGIGSVLTHRFPDGSEKAIYHNSQALTAAQRNYSQ
IEKEALGLVTAVTKYHRFIHGRHFTLRTDHKPLLSIFGDKKGVPVYSANRLQRWATILLN
YDYSIEYVNTHDFGQADALSRLIAEQSQSKEVEDQVIGQVECEVIANLVSTCNSLPVTVD
MISSASTKETIIAEAINNVKHNSWPNKMDHGSILWNFFNRREQLSIVKDCLMLGDRVVHH
RVLKMLHRAHPGMVRMKQLARSFVYWPSLDKDIESTVRSCDDCAAAAKDPIKNTLCSWPT
PTAPWTRVHADYAGPIEGTYYLVIVDSYSKWPEVIATKSITSTSTISIFRKVFAQFGNPK
TLVTDNGTQFTSTQFIDFCKEHGIQHIRSPPFHPQSNGQAERFVDTMKRALRKITRGGKR
RHCNPGIPSELPFYPHAKQARTTCRLLRTSLDGRSAPHWTFLX
Download sequence
Identical sequences CJA23787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]