SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA23968 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA23968
Domain Number 1 Region: 98-349
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 5.4e-43
Family D-lactate dehydrogenase 0.021
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.48e-41
Family FAD-linked oxidases, N-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 358-429
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.92e-22
Family GntR-like transcriptional regulators 0.02
Further Details:      
 
Domain Number 4 Region: 448-579
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.54e-21
Family GntR ligand-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA23968   Protein: JA31790   Gene: WBGene00179540
Sequence length 586
Comment JA31790 WBGene00179540 status:Predicted
Sequence
MNNIRQVDPDDFSAIVEAGCILLEMKTQLAAQGMFFPLSLGAQGSCRIGGNVSTNAGGVN
VLRYGMTRELVLGLEVVLPDGAIFNGLSTLRKDNRGIDLKQLFIGAEGIFGIVTAVAIKL
MPLPDKIETAMLGLNSLEDAIALYRRARVQCCDLMSAFEFMPPVAFTLAQEAIPDLVAPL
GQYPAYVLMEISGSGLVDTAVLMEAFLNEAVESGLVLDGTIASSHMQAQNLWQFREGMNA
GQGLRGKHLRTDVSVPLSKLAAFVAEAEAELAEVLPDCLPISYGHVGDGNVHLNVIPPRD
LDIASKDEKIKLAKQTINAVLDRYAGSISAEHGIGRLKREDFEKRLDPEQAVFGEIRRNE
QLPARIASEIVRQITEGSFLPGHKLPTEHNLAQSFGVSRSVIREAIAQLRNEGLIETRQG
VGAFVTEPDRRHAIRIEPETLADQHHFQSLFQLRMALEIEAAGLAAVHHTAEDMRKLDEA
MAEMNGTEKWTDEGISADLTFHRALAAATHNEYFPLVLGFIAERINQAIRAARARAVLEE
IVEITIAEHTAIRDAIALRDPLKAREVMRHHVVSAASRVNLQLEIF
Download sequence
Identical sequences CJA23968 281687.CJA23968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]