SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA23978 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA23978
Domain Number 1 Region: 110-536
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.69e-139
Family Reverse transcriptase 0.000029
Further Details:      
 
Domain Number 2 Region: 704-858
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.59e-42
Family Retroviral integrase, catalytic domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA23978   Protein: JA20912   Gene: WBGene00179550
Sequence length 1023
Comment JA20912 WBGene00179550 status:Predicted
Sequence
MITIGNKSVDIIGPQKAAFAPTNALMEVLCAEDVIIHPGQDQIIQIANPKDTQDDEAVLL
KSTPNSPLIFEKTIFHPLETRGTALRVKNMSNKIIRLTEGETIGSGTIFFNEDGEIGLFN
GGVEHKIELRKDLPFPKSRTYRVPLGNQSEVERQVQEMLKMGIIEHSTSTFVSPIVLVRK
KDKSYRFTTDYRLLNAVTIKLNYLIPHISDIVDLAAGGKYFTNLDLVQGFFQIPLRKSDR
HLTSFVTPTGTYQYRRMPMGLCGAPHTFQTAVRQLQKRVKAKLFCYLDDLLIVSETFEDH
LADLDEVFQQIAKIGFKIKAEKCAFAQQEVTFLGLLVGRDGIKPNPAKVKAIKEFPTPQS
PTGIRSFLGITNYFRKFIYHYAEIAEPLHHLTRKDVKFEWKEEQQDAFDKLKIALCSAPV
LNPPVAGKPYVIESDASSIAVGALLLQEGSDQELHPIAYASRKLNNAERKYPPIETEALA
LVFAIAQFRTYILGSAITAIVDHRPLTSLMHRRDLIGRLAKYQIILQELDLKILYRPGRL
NSVCDALSRYIGGEIKEARSSSKEAKSEVNAVESVDELNQEKLKEIQSQTIFIQEIARKL
TQSNATNNKYEERDGVIYKKTPEGLAALLPEDKMITNAVMNQYHRQAHLGAHLGSEKMIK
IIGRRFFWNNMAQHIQKYVKKCTECQRRKVNPHQETKEPLGELEELTGPWQRLHADICGP
FPITMNGNRYICTVKDDFTKYALAIPIQKQDADTIADVFVKEVILKFGSPKTLLTDNGTN
FRSETFTEMLKIVKTEHSLTAPYHKTANGTVERLHRTIEEALSSFVNSSQTDWDKKLPYV
MFALNAAPHATTKISPHMALFGRELKTPEDIKLATPINSYYDVEDFVTCLQLQMKDMNEL
IRQRIQDKKEKSKKTYGESNRIAERKIEIGQRVFVRRELPKNKLAPRLRGPFEVTGVTQF
NIEYKDGKKTKKANKNDVQVVPEDLEDNGNRNNGPDSEVSEAVNESQDVRRLRRSKRIAS
KGT
Download sequence
Identical sequences CJA23978 281687.CJA23978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]