SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA24219 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA24219
Domain Number 1 Region: 95-222
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.23e-18
Family GntR ligand-binding domain-like 0.016
Further Details:      
 
Domain Number 2 Region: 18-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.15e-16
Family GntR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA24219   Protein: JA26767   Gene: WBGene00179791
Sequence length 227
Comment JA26767 WBGene00179791 status:Predicted
Sequence
MEHASVHDKTAKNSATLIDSWGSESLAEQAYRVLERSIVTLELEPGAIVNERSLIELTGM
GRTPIREAIQRLAWEGLVEVRPRSGIAIAQIDPTDFTKVLDAREGVERVLARDAARFGSA
RDYERLKAAADAMRQAIPSEDVSLFLDADKAFDIVLGTAASNPYAARLAAPLQTHSRRFW
FRLRPSTGITGSANAHATLIEAIVSREPERASDTASELMAYLRTLAP
Download sequence
Identical sequences WP_024895793.1.22424 281687.CJA24219 CJA24219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]