SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA24389 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA24389
Domain Number 1 Region: 83-214
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.23e-22
Family GntR ligand-binding domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.62e-20
Family GntR-like transcriptional regulators 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA24389   Protein: JA19954   Gene: WBGene00179961
Sequence length 229
Comment JA19954 WBGene00179961 status:Predicted
Sequence
MESLMTNKIGRQSLTDQIVVELRRRIIAGELAEGTPLRQEALATELGVSRIPIREAIRQL
EAEGFVQSELHKGTVVKALSLAEIQELFDIRIHLETWLFEMAIPRLSDADLRRAEQLTDE
TLVDGNVENWGDLNWQFHETLYAPSGRTVALKLLKSVHDNANRYINLQIAVAQDVELELS
DHRALLAYAKLKDTERAVETLRKHIQRVANNLMKSLIESRSDQREQETA
Download sequence
Identical sequences CJA24389 281687.CJA24389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]