SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA25065 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA25065
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.45e-17
Family GntR-like transcriptional regulators 0.024
Further Details:      
 
Domain Number 2 Region: 68-156
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0000000994
Family GntR ligand-binding domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA25065   Protein: JA38272   Gene: WBGene00180637
Sequence length 161
Comment JA38272 WBGene00180637 status:Predicted
Sequence
MQVAADLRRRILEGELVPGQRLKIDEIAVMCGVSHMPVRTALQELESEGIIAVHPRRGAE
IRTIDAEYITSMLDVRGAMEVMLTAKCATMIDEAGLVTMERLVINFEEKAKLQDPPAMLH
ANLELHSFINGIAKNSEALRVLGRGRLLIEAMRIRYGYGGD
Download sequence
Identical sequences 281687.CJA25065 CJA25065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]