SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA25281 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA25281
Domain Number 1 Region: 6-81
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000147
Family RpiR-like 0.0081
Further Details:      
 
Domain Number 2 Region: 107-228
Classification Level Classification E-value
Superfamily SIS domain 0.0000000000156
Family mono-SIS domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA25281   Protein: JA20420   Gene: WBGene00180853
Sequence length 229
Comment JA20420 WBGene00180853 status:Predicted
Sequence
MNAAPRSFLSRVRDVLKDLPPAEKRLGDFVCDFPGELASYSASELASLAHVSNATVTRFV
RRLGYESYEESRRHAREEKQTGSRLFLSSVTDQTEGQSLAAHIGQGIANLEKTFLSIRDA
QIDAVIEILLTTRKTWVMGFRSSQPFASYLQWQMMQVVDNIVAVPGPGQTLAEYIAAIAP
NDLVIVFALRRRVAKMDDILSVIEKRGAKLLYITDEGAPLRSSAQWHFY
Download sequence
Identical sequences CJA25281 281687.CJA25281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]