SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA25366 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA25366
Domain Number 1 Region: 283-440
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.07e-41
Family Retroviral integrase, catalytic domain 0.0059
Further Details:      
 
Domain Number 2 Region: 1-137
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.19e-28
Family Reverse transcriptase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA25366   Protein: JA28902   Gene: WBGene00180938
Sequence length 598
Comment JA28902 WBGene00180938 status:Predicted
Sequence
CQKAFERIKEILQSDLLLTHFDPKLPIIVAADASQYGIGSVLTHRFPDGSEKAIYHNSQA
LTAAQRNYSQIEKEALGLVTAVTKYHRFIHGRHFTLRTDHKPLLSIFGDKKGVPVYSANR
LQRWATILLNYDFSIEYVNTHDFGQADALSRLIVEQSQSKEVEDQVIGQVECEVIANLVS
TCNSLPVTVDMISSASTKDLSIVKDCLMLGDRVVIPTALRHRVLKMLHRAHPGMVRMKQL
ARSFVYWPSLDKDIESTVRSCDDCAAAAKDPIKNTLCSWPTPTAPWTRVHADYAGPIEGT
YYLVIVDSYSKWPEVIATKSITSTSTISIFRKVFAQFGNPKTLVTDNGTQFTSTQFINFC
KEHGIQHIRSPPFHPQSNGQAERFVDTMKRALRKLQGEGNADTAIQVFLQNYRSTPCEAS
PHYLSPAENFIGRKIRTTLDLLLPSSESPTARNDSMEAQFNRHHGARERMFQEHDKVYVK
DFRNPQNATWISGVVQKRIGRTLYKVLVNGSVWKRHTNQLRRRDIAPFAGSTDIWYLDVV
TPSRADNSNQLPSTTQPTPASPTSPRLIAPTQPTIRTSTRHRNPVKKLDIDPRTKSYK
Download sequence
Identical sequences CJA25366 281687.CJA25366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]