SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA25779 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA25779
Domain Number 1 Region: 101-232
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.71e-27
Family GntR ligand-binding domain-like 0.0094
Further Details:      
 
Domain Number 2 Region: 10-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.23e-17
Family GntR-like transcriptional regulators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA25779   Protein: JA30742   Gene: WBGene00181351
Sequence length 234
Comment JA30742 WBGene00181351 status:Predicted
Sequence
MTQAIEPIIRRKLSDEVFDRLENMITSGELTPGDEMPSERVLMERFGVGRPAIREAMQSL
AKMGLVNISHGERAKVLKLTARSIFQQVDPTAKIMLAQSLDTLEHLKSARIFFERGIARE
AAQKASEQDVADLRAIVERQRESLGDADAFISADMEFHIRIAKISGNPIFVGVSEAMLAW
LREYHTHMLIWTGKEKYTLVEHEEIIDMLAAKNSDGAEAAMLRHLERSRALYTK
Download sequence
Identical sequences WP_024900164.1.22424 CJA25779 281687.CJA25779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]