SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA25785 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA25785
Domain Number 1 Region: 49-95
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000654
Family Second domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA25785   Protein: JA32560   Gene: WBGene00181357
Sequence length 109
Comment JA32560 WBGene00181357 status:Predicted
Sequence
MAYTPCYHGFLVFALLVDLVRFSTQSLPSAMGCRLSITPYLPWEFSFEVKFYPTTPTTIV
DDHARYYVFLQLRRDILTGRLPATADTHALHGSFVVEMKIMCIKCYFFF
Download sequence
Identical sequences 281687.CJA25785 CJA25785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]