SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA25947 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA25947
Domain Number 1 Region: 124-169
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000129
Family Second domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA25947   Protein: JA35530   Gene: WBGene00181519
Sequence length 184
Comment JA35530 WBGene00181519 status:Predicted
Sequence
MHFVPNERIIKQLLFEQEIVRIEVCRICARDSDKCDCSECDLSEIVFLDLSEQLRSVLEV
FGEEIRKIHHKIVCGETTSSPLGSEFLRSKYFTQTSAHDLHLHFVSGFDGIRLHNLPWEF
SFEVKFYPTTPTTIVDDHARYYASLQLRRDILTGRLPATADNHALHGSFVVEMKIMCIKC
YFFF
Download sequence
Identical sequences 281687.CJA25947 CJA25947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]