SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA26265 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA26265
Domain Number 1 Region: 105-239
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 6.8e-26
Family GntR ligand-binding domain-like 0.0066
Further Details:      
 
Domain Number 2 Region: 9-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.91e-18
Family GntR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA26265   Protein: JA25640   Gene: WBGene00181837
Sequence length 250
Comment JA25640 WBGene00181837 status:Predicted
Sequence
MVIGSVSPHVDRGKLHMHIVATIEARILSGELQVGERLPSEAEIGRTFGVSTRSVREAMQ
VLETKGLVRRKHGERAEVVRDDVGEFMDSLVSSVGSLFARDSSYLVQAMDVRRLIEVDVA
GRLASGEGQLRDGVTAALDVMRQSAGDNDFSRFAEGDAAFHRALVQSLGNEILSSLHANL
HSLISEVIKVSSRVPRKKLSAGLAEHENIYGLIAAGKAGDAREAMREHITNSTAYLEQAI
RQSRNRPETG
Download sequence
Identical sequences A0A248U8Q2
281687.CJA26265 CJA26265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]