SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA26488 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA26488
Domain Number 1 Region: 248-310
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000912
Family cAMP-binding domain 0.0071
Further Details:      
 
Weak hits

Sequence:  CJA26488
Domain Number - Region: 112-194
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0863
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA26488   Protein: JA23053   Gene: WBGene00182060
Sequence length 358
Comment JA23053 WBGene00182060 status:Predicted
Sequence
MSSVSRPSKNFSEKYAGHRFPRPRRLRVLPVIFYFFVTNCVQTPRRQNAENFLKRQRKSA
FTVLSASLEISLWSRDVFRSEPHGRHVRRFVQVGSRTFEAHELQKLIPQLEEAITRKDAQ
LKQQQSIVEGHIKRISELEGEVTTLQKKNRKRLEFCGKTTNVFNFQRECDKLRSVLEQKA
QSAASPGQPPSPSPRTDQLGNDLQHKAVLPADGGTQRAKKIAVSAEPTNFENKPATLQHY
NKTVGAKQLIRDSVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVA
GRAASVSRRSTSRKNASWNSDGRARHSLQLYQVNRSILRIVAEFVAGFSYFVNNPKNF
Download sequence
Identical sequences 281687.CJA26488 CJA26488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]