SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA26554 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CJA26554
Domain Number - Region: 54-79
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0795
Family Second domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA26554   Protein: JA20577   Gene: WBGene00182126
Sequence length 84
Comment JA20577 WBGene00182126 status:Predicted
Sequence
MSSNSPSRWHRLIWRRHGNLNIRRCASGMFSARAQDISIHSSGSDLPWEFSFEVKFYPTT
PTTIVDDHARYYVFLQLTALLLLR
Download sequence
Identical sequences CJA26554 281687.CJA26554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]