SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA26934 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA26934
Domain Number 1 Region: 15-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-65
Family ABC transporter ATPase domain-like 0.0000496
Further Details:      
 
Domain Number 2 Region: 277-351
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.23e-16
Family GntR-like transcriptional regulators 0.0068
Further Details:      
 
Domain Number 3 Region: 369-507
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000000000000523
Family GntR ligand-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA26934   Protein: JA34629   Gene: WBGene00182506
Sequence length 519
Comment JA34629 WBGene00182506 status:Predicted
Sequence
PQTDGGRHMSEAAISVHNLSKTFGGGRTFFGKQRHTVEAVKSVSLNLARGETLAIVGESG
SGKSTLARMLVGLTEPSDGTMKIAGQDASALRRSGPRAFGKVIQYVFQDPVASLNPRKTV
RQILETPLKLLGGLDRNQRQKRMEELLNAVQMPKDTLLRYPHEFSGGQAQRIAIARTLAA
DAEIIVLDEPVSALDVSVQAQVLLLLDKLKQQFGLSYLFISHDLAVVEAISDRVAVMYYG
EIVEEATAEALFAKPQHAYTLGMARNSRSKSESASLTKSKRRPEVIADRIKDVIQTDHLK
PGDRLPQEKDLIDQFKAAKGTVREAMKALETQGLLFTRTGPGGGVFVAEPSAQHAMEMLG
NYFFFDQPGLQEIYSIRKLLEPEVAASLAGKLSQDDLKKLDNTMRFYDRPPTNLDDQFQQ
RVAELDFHTQLAQLCPNRLLGFMCGLTHNLLRNMPVARSIYADPTPATREEGLLFQHRLL
TALMENRAEDARKIALEHMISAEKYMISKENELKKAATT
Download sequence
Identical sequences CJA26934 281687.CJA26934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]