SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA27138 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27138
Domain Number 1 Region: 87-220
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.14e-20
Family GntR ligand-binding domain-like 0.025
Further Details:      
 
Domain Number 2 Region: 17-85
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.66e-19
Family GntR-like transcriptional regulators 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27138   Protein: JA28215   Gene: WBGene00182710
Sequence length 234
Comment JA28215 WBGene00182710 status:Predicted
Sequence
MNGRTPPIDFKVVKAAAPVRHSVTESIRNSIAVGYFTAGQRITERDLCEMTGVSRTAVRE
ALRQLESEGLVEVVPHRGPIVARLKPEQAEGIYQVRVELEGLACELFARNATDEDIEALK
AAFEVLKQGDKITDPLERLQAKNAFYDCLIFGAHNEALGHTLSSLNARVMVLRATSLGAP
GRTRDSLAELGEVVGHLAARRGKEARKAAAYHVMNAGKVAIAILRERLAEEADA
Download sequence
Identical sequences CJA27138 281687.CJA27138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]