SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA27426 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CJA27426
Domain Number - Region: 2-25
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000269
Family Second domain of FERM 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27426   Protein: JA25922   Gene: WBGene00182998
Sequence length 70
Comment JA25922 WBGene00182998 status:Predicted
Sequence
IDNHARYYVFLQLRRDILTGRQPPPTLMPSSLLLSLKSSLAMRPHKSMTKVSRTERTDGF
GGGDFVPGPX
Download sequence
Identical sequences CJA27426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]