SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA27530 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27530
Domain Number 1 Region: 247-443
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.56e-33
Family Reverse transcriptase 0.0038
Further Details:      
 
Domain Number 2 Region: 182-213
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000314
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27530   Protein: JA39195   Gene: WBGene00183102
Sequence length 446
Comment JA39195 WBGene00183102 status:Predicted
Sequence
MAEQDERDRLLSLLGQDVMERMLPKVKEMLANKEEEKAPEIGQKGLMVQAELNAKMINML
RAAMDEEDPKKGIKDVIETLRQRNTELQLLDRNPEALKTVERMKAVAALTGTDADSQKLI
ALAQVLMDSSGRSARPTGSSAQWFRAPGSSYANGGVRSQPSSNFRRFGAQKRPGSTSSTS
LERGYGKIGGAGPECYACHSIGHFSRNCPQRRYSERGETITKVIFLGIENFELPPPEGLR
ESVKPNMTFIIAEISKLEESGVVVDEADPQVVSPLHVAMNGTKPRMILDLKKLNQALTPP
HFRVEDWNTVWPCLDSARFACSFDFKSGYHHIKVSEESSKLLAFSLSNPPGPPFKKFTSL
PFGLSTAPFIFTKVFRVLVGRWRKKGIKIWLYLDDGLILAETQEEMRRAVGIVRKDLSDA
GVVIAEGKSVWIPSEQFVWLGIQYWP
Download sequence
Identical sequences CJA27530 281687.CJA27530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]