SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA27761 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27761
Domain Number 1 Region: 11-57
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000196
Family Second domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27761   Protein: JA30542   Gene: WBGene00183334
Sequence length 71
Comment JA30542 WBGene00183334 status:Predicted
Sequence
MDLPWEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDILTGRLPATADTHALHGSFVVEM
KIMCIKCYFFF
Download sequence
Identical sequences 281687.CJA27761 CJA27761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]