SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA27764 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27764
Domain Number 1 Region: 17-63
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000262
Family Second domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27764   Protein: JA19595   Gene: WBGene00183337
Sequence length 77
Comment JA19595 WBGene00183337 status:Predicted
Sequence
MFFGNVEDLPWEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDILTGRLPATADTHALHG
SFVVEMKIMCIKCYFFF
Download sequence
Identical sequences 281687.CJA27764 CJA27764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]