SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA27779 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27779
Domain Number 1 Region: 21-67
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000301
Family Second domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27779   Protein: JA21442   Gene: WBGene00183352
Sequence length 81
Comment JA21442 WBGene00183352 status:Predicted
Sequence
MTRRDLHGVLRDLPWEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDILTGRLPATADTH
ALHGSFVVEMKIMCIKCYFFF
Download sequence
Identical sequences CJA27779 281687.CJA27779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]