SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA27965 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27965
Domain Number 1 Region: 676-827
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.06e-36
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 
Domain Number 2 Region: 415-486
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000534
Family Reverse transcriptase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27965   Protein: JA38101   Gene: WBGene00183538
Sequence length 2067
Comment JA38101 WBGene00183538 status:Predicted
Sequence
MGYCPNKPXKLQNLTISKQPQGNSVSPLGEQVNPRFPDKAEVAAPVSGKSRRNPEANTEE
SKSEKKSRVTSNEAPARVDAATSQSCGKAPAGPQEDIIVASQSNVAPERNAQHPSIYVST
QSDSQQAEAADANKKGTTRSSSPNRRVTRATSASQQPRVNVFAMKRAATIQIFPEPTRKI
FTYLCATSRTTSLTSRTQRHQGMPPVNPEVRTNTGRQDDSSAPMHVSSGSFPTALPECAQ
RRKPADHVRKHPLPFHRYTIQAATSYIKSYPIHGDRRHNSAKSAQSTEKTSRGFLVFVYR
RANNSLQLLCFRQSPPSSPMSSPSRKKRPKDPDSPTTDKPNDQVQFSPGRHTDVAHEDEL
VLAADGPKKPLRDTPASSLATAAVAPASFETTSTASIPVSTPVNNSGHPSAVSSSSQIST
HDAETAAQRLISQWEDDYDIEIILHSDHRPLSYLLSKHKVNDNLARWLIELQQYDIKIVH
IDGKKNTVADYLSRMQGESQPKETELEDIVSFPVCMANTTYEHVPPTVLRISGMNSIDIN
EEQRKDPVLASVRALVEKRPTPCIDLPNEWKHHLKFVKISTRGTLVINFPGTPGLVEDKT
IVPEALRELVITGHHASLLGGGHFHWRPTMHKTQKKFFWPGMRTSIIQHCLRCQQCQLRR
SKPPTQREQQLVVPTNYVFQRVGIDLTGPLPVTAQGNRYYMNAICWFTRYVISIPLPDTR
ADTCARALLNHVVLKYGAMSELISDGASGFTSAAFEHFCALLEIQHHTAIPHHSRGNGST
ERTFRTFHNSMAKYVNNKHNDWEDHLQAVAFAYNTAQHSTTGESPFYLMYGRDPVFPIEK
DYPPGTRKRCTQTRTNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXREASRPPPFGAEYLPPQTQQVPLIDKSVGSSK
VRIKTLEKKRATMAFADVLPRAELNTPPETHSVKRSADSDSGKLQNFTIIKQPQGNSVSP
PGEQVNPSFSDKAELSAPVSGRSRRIPVANTEASTSEKKSRVTSNEAPARVVAAMSQSCG
KAPAGPQEDIIVASQSNVALEHNAQHPLINVITQSDSQQAAAAANKRGTTRSRSPNRRVT
RAMSVSQHPRINVFPMKCAATIQISPEPTRKICTYLCATSRTTSLTSRTQRHQGMPPVNP
EVRTNTGRQDDSSAPMHVSSGSFPTALPECAQRRKPADHVRKHPRNKSENVDLDETDNGS
FDRLRNVLGNLNPAIGLMHNTRYFKEK
Download sequence
Identical sequences CJA27965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]