SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA28409 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA28409
Domain Number 1 Region: 61-107
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000196
Family Second domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA28409   Protein: JA30828   Gene: WBGene00183983
Sequence length 121
Comment JA30828 WBGene00183983 status:Predicted
Sequence
MAKLPDVACSTAARLPDSEEYYDGTQLGRGRVSTTAGTTTCFKVGMAWRRLDLPQEFSFE
VKFYSTTPTTIVDDHARYYVFLQLRRDILTGRLPATADTHALHGSFVVEMTIKCIKCYFF
F
Download sequence
Identical sequences CJA28409 281687.CJA28409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]