SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA28448 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA28448
Domain Number 1 Region: 74-191
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000014
Family Retroviral integrase, catalytic domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA28448   Protein: JA29522   Gene: WBGene00184022
Sequence length 235
Comment JA29522 WBGene00184022 status:Predicted
Sequence
MRDHKLTELIVRDLHIQNKHIGTEHLVTKIREKYWIPKCKQLARSVIRTCTVCRRLTGKK
FKYPSVPALPSYRVRRSRPFESIGLDYFGPIYYNGRITDKKIWVMICTCLVTRNIHLEVV
PDNTTYQFVLAMRRFFARRGTPRRVVLDNARTFKLGERIFNGDIKQMCENDEFFTAFLDS
QPMEWNFITPLTRECPGLNLGFRDESYMIRKIILWRFKNYFSFLLNAGGFRENRV
Download sequence
Identical sequences 281687.CJA28448 CJA28448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]