SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA28508 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA28508
Domain Number 1 Region: 12-57
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000563
Family Second domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA28508   Protein: JA33234   Gene: WBGene00184082
Sequence length 72
Comment JA33234 WBGene00184082 status:Predicted
Sequence
MINLPWEFSFEVKFYPTTPTTIVDDHARYYAFLQLRRDILTGRLPATADTQALHGSFVVE
MKIMCIKCYFFF
Download sequence
Identical sequences 281687.CJA28508 CJA28508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]