SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA29068 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA29068
Domain Number 1 Region: 83-216
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.62e-22
Family GntR ligand-binding domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 13-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000999
Family GntR-like transcriptional regulators 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA29068   Protein: JA20730   Gene: WBGene00184642
Sequence length 224
Comment JA20730 WBGene00184642 status:Predicted
Sequence
MHKIAELQTLVHENLGDVVYRKLSEALMRGKFAPGTRLTIRELAASLGTSVTPVRDALLR
LIQDNALIQKTPRDVRVPILTPERYCEIRDIRVRLEGLAVSRAAVAATSEDIARLWSIIN
DNEIAIEEQRWEDALECNQIFHSAFAEIARMPSLITILGTLWLQMGPLIAGIYEYGGRHM
IEDHYIVVKAIEARDADAAEAALAKDILDASELILERIAALLRE
Download sequence
Identical sequences 281687.CJA29068 CJA29068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]