SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA00229 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA00229
Domain Number 1 Region: 1306-1403
Classification Level Classification E-value
Superfamily Immunoglobulin 2.59e-23
Family I set domains 0.0027
Further Details:      
 
Domain Number 2 Region: 1414-1508
Classification Level Classification E-value
Superfamily Immunoglobulin 2.17e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 2411-2502
Classification Level Classification E-value
Superfamily Immunoglobulin 6.74e-19
Family I set domains 0.0071
Further Details:      
 
Domain Number 4 Region: 2508-2605
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-18
Family I set domains 0.0055
Further Details:      
 
Domain Number 5 Region: 1201-1293
Classification Level Classification E-value
Superfamily Immunoglobulin 1.59e-18
Family I set domains 0.0037
Further Details:      
 
Domain Number 6 Region: 2228-2322
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000195
Family I set domains 0.017
Further Details:      
 
Domain Number 7 Region: 61-163
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000125
Family Spectrin repeat 0.0037
Further Details:      
 
Weak hits

Sequence:  CJA00229
Domain Number - Region: 414-538
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000352
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number - Region: 962-1034
Classification Level Classification E-value
Superfamily Spectrin repeat 0.056
Family Spectrin repeat 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA00229   Protein: JA24857   Gene: WBGene00119433
Sequence length 2642
Comment JA24857 WBGene00119433 status:Predicted
Sequence
MAPGGAPIDANRMEMAATQNGKDGEHDKSTTTLSTIAVKAGVNASIVVALLKNENPIFVS
FLQSNGYMQLRVDEMQPKLLSIGSRSQETRDLLKIHDDLISRLQDKDDQVAALLSRADNL
GAEKTNPDETIVYDDMAKSLRETWRSLNRQLLLRGYMLRETVQFYELAESHEKLTQKTVE
IVHQISGHNSAQLQLSVNKLINEIIDTTATVVDLGSSVISQIRTLGQIDDNPARPQEILD
ASVKIEHVMLRVASDWEKSETLWQEKQFESQQQRTTTTTEDELVVIEQWLEYAEKKVKAL
NESGQKNVLLEGNKYVARLRELAQTPSSDGGRISHLSGRIEEFLHYLKTRMNRSQRIQTF
LQAAKSMISQLNMMVEDMKNANAALAGELAPLAKQKGSPLIHEGKDISAKEVLSYEEQRL
VRQYIEDLSEKLREIEDLAKQRKESGKTTSHFSSIKTWLDGPAAAFLAQKGDMGGNQSDA
RDFVSSHKQFATDVINRDADVMSLLAKKPQMSPEEEQQLNEFVKSYEKVKDILENRIQIG
TTYEQVHKFGKDLEGSFDALQVLLENNQEYTNEKVSAQIANVFQMILETLSQEKHQGILH
FNQICIICFIISADKFISNAQQIGKSDEWLNIQRAQEAVRNMITDHENRFKYVQHKWNEW
QRDKSSQTKTERVIEEIQMWQTDVLEFIGKVDNSTVSRKEEVEEIQKKIAAFQNAADVHK
STLETLKEENKNEEQISRINVLLDKNEYIKTRLEQLHQKVELTSLLKVVEDVQIWQEEMV
EIIRSMNQVITTQSNNQEQYEKVRRKIEDLKVEVDKKSEHLEACKTLSQNQTFQAQLHKT
IINQEQIRQTTQELQQKLEISKLIRVVEEIQMWQEEAIEIIRMLDRTQPANIQEANELID
RVHDLQETIEHKSSKIQEIKKMSTVPEFVQKMKEVEHVQEQLKHLTVELEEKIEQQKLVK
VTEEIQMWQEEMVEIIKMFDSTPMKSVQESEELREKVKLVKEAIAVQQPKIEEVISKARD
VSVKTQVARAVEKQKIIKEMAENLERKAISASFELSKPQQTVEEAKTIELTTLEQTQITL
SPEEKKELQILKKIVEEIQMWQEETIEIIKLFDNTPVKTVQESETIVKKVNEINQTVEAQ
TRRLEDAARFTKDESYTTTVQETMSKQEQVKQLVKELKERATQQNIVVRRQEEERQRIQA
PQIITQLKDAEVDEGARYEFSATIKGTPEPTISWLKDGIDVKSSMDYRQDYVNGVATLVI
EESFIEDTAEYTVKATNVGGTAASSANLIVKSRSAMSSAILEEDKPRFVKQMQSVQVNEG
ETAHLDCVVVGKPEPEVTWFKEETAVKESERVRLQFSGDHCQMVIERTVPLDTGIYTVRA
KNVHGEVANFCQLRVVPKKQPPPQTPPKPRTPIQRAPIIQPSLTNTTWEEGETATLQVFS
YGEPKPRVQWKFNDIPVQTSSQVQITEQDDGWSKLTIQQISPVNAGMYTAVAENEIGEAV
TGATVHVQPSMKRVVTTEHHLQEELNERIGQPVQQTIITKKYEELDNRERTAFPQPREPE
RITEEKRWVELVEQHFEDHLSQHSVSPVPQTREMRKIESQQRWIDTIDEIWSPPKEIEVK
ETRTTSGIDHYSAHSVHEPSPRPVGFHTTTTTTSVSHIGQSHEPVQPTMGRSTSSNETVR
TMNIATIRQSPQRELYEARTTPGPTSEHVATIRTTPVRETYQTSISKAPSLENVAKIRQS
PVPETHRSTLTRRSPSVENIAKYQPATQQPDAHRATMTGGQPVANIAKVHTPSQPERRTI
SKEAPKIDRIDDILATPHEEKVTTTVKQTEVITTDIDVKKKIPNEKFKPFFLQKQHQERP
LQQQVKNTITETTTGEGWVQHQHQDFIEPHKSTVTVKKLDIEEQQNIHQQNLAQPEQKHI
VTENIEEDIYKESRIPVKREPKTTTTVTETTSGEGWVQNVHQDLQQPHLSTVSVKRLDIE
EGHHENNYQSQQQIPQQLTKYSKIEEEENTKKTQNESKIPVKREPKNTTTVTETTSGEGW
VQNVYQNLQNPQLSTVTVKKLNIEDEERTKKSEQSAKPQVTTNKKLEEDEELRTKHVAQE
SRIPIKKEPKTTTTVTETTSGEGWIQNAHTDATRGSTVTVKRLGIEEEDRRNVARSARPI
STEIRRQTDEESSIRHRDSFIQASDVEGFWTDGAYTDSAPTPPPQPIHRMTAEDNMQRIG
LSRTTTEPEFIKAFEREYTVEEGGRIAIECILVGNPKPAARFFFNNKQVTEKSEFLKICH
VNDTYSIIISPAKLEHAGYYKMIAENKRGVTESLTVLHVRPRSLQTYQQQKQQETQSRLS
QQQQQNRAGPTEYTTVEEEFAMFEYEQRRPQKHDTSKLATPPPAKRIQQEHKKDEEHLET
YDLEGQKTTGHPPHFTQTLVSTVVAQGESSTFEGIVTGWPAPTVEWTIDGRPLDLKDVRV
SNIGGRVSLNFLNCQLSHAGKYMCTAKNTSGVATSSAQLVVRPKTIAPDFIQRLISEEVE
EGSQLKWSVRVTGDPMPKVIWMRDGYEIPDCEEVRIVDHGDGFHSLVIVRVEGADSGQFT
CLAENIAGEARSTADLVVRPTGTAPGNYFHVTKVTQEKQAKGAEPQTNSAFSIETPRQSE
ML
Download sequence
Identical sequences CJA00229 281687.CJA00229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]