SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA00448 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA00448
Domain Number 1 Region: 1538-1796
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-48
Family YWTD domain 0.00000886
Further Details:      
 
Domain Number 2 Region: 3367-3633
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-44
Family YWTD domain 0.00000908
Further Details:      
 
Domain Number 3 Region: 401-670
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-38
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 2179-2415
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-30
Family YWTD domain 0.00015
Further Details:      
 
Domain Number 5 Region: 772-982
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-30
Family YWTD domain 0.0012
Further Details:      
 
Domain Number 6 Region: 4265-4513
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-28
Family YWTD domain 0.0003
Further Details:      
 
Domain Number 7 Region: 2526-2761
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-27
Family YWTD domain 0.00018
Further Details:      
 
Domain Number 8 Region: 1910-2102
Classification Level Classification E-value
Superfamily YWTD domain 1.28e-25
Family YWTD domain 0.00063
Further Details:      
 
Domain Number 9 Region: 3259-3358,3626-3687
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.14e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 10 Region: 1196-1236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000072
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 11 Region: 1067-1102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000956
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 12 Region: 1323-1358
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 13 Region: 3186-3227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 1234-1276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000114
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 15 Region: 3007-3049
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 16 Region: 4009-4046
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 17 Region: 3929-3966
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 1282-1318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 19 Region: 3804-3839
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 20 Region: 3152-3186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 21 Region: 3717-3758
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 22 Region: 1157-1194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 23 Region: 54-92
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 24 Region: 222-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000798
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 25 Region: 3679-3715
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 26 Region: 2880-2922
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 27 Region: 183-221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 28 Region: 4100-4136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 29 Region: 3060-3093
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000089
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 30 Region: 264-301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000089
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 31 Region: 3761-3799
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000969
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 32 Region: 3964-4004
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 33 Region: 3889-3922
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 34 Region: 2845-2882
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 35 Region: 1370-1405
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000107
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 36 Region: 3845-3881
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000127
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 37 Region: 2925-2955
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000013
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 38 Region: 4150-4192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000223
Family EGF-type module 0.015
Further Details:      
 
Domain Number 39 Region: 4185-4215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000287
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 40 Region: 96-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000034
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 41 Region: 1491-1528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000387
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 42 Region: 1113-1149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000471
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 43 Region: 1799-1840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000957
Family EGF-type module 0.023
Further Details:      
 
Domain Number 44 Region: 3098-3146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000118
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 45 Region: 2971-3009
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 46 Region: 142-178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  CJA00448
Domain Number - Region: 2135-2178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00067
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 310-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000729
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4052-4092
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00196
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 4533-4566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00323
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 1414-1448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA00448   Protein: JA21078   Gene: WBGene00119652
Sequence length 4802
Comment JA21078 WBGene00119652 locus:Cjp-lrp-1 status:Partially_confirmed
Sequence
MILRFLIFTALAASAVNSSTRQSSAPASSFHSIQVDSPPSVRSRIISASVNSASAICNEN
DFRCNDGKCIRNEWKCDGSGDCSDGEDEKDCPHPGCKSDQWQCDTYTWHSVSCIAEYQRC
DNITDCADGSDEKDCPASQVDCSSPNVFMCADGRQCFDVSKKCDGKYDCRDLSDEKDSCS
RNHTACFQYQFRCADKTQCIQKSWVCDGSKDCADGSDEPDTCEFKKCTANEFQCKNKRCQ
PRKFRCDYYDDCGDNSDEEECGEYRCPPGKWNCPGTGHCIDQLKLCDGSKDCADGADEQQ
CSQNLCPSLGCQAGCHPSPHGGECTCPSGYKLDDRFHRTCSDINECAEFGYCDQLCANHR
PGFTCSCLGDCFTLQMEHGPGKDNLTMRGYCVSNNADKMRLFIARREGLYRINPKNINEE
AKKLASGEFIYGIDFDYGDRKIFWTDRLAHSAFSADVDDEGEISQIRKLSLKSLVYPRCL
AVDWITNTLYIIESGSRRIDVSSYDGDRRTVLLADGLTLPLDLALDPLRGEMFFTNQLKI
EAAAMDGTNRRTLVNTHTHQVSGIVVDITAKRVYWVDPKVDRLESIDYQVSLSVRQLNGN
DRRVVVQGMNVVPHPFGLTLFDQYLYWTDWTRLGVIQVEKFGSETKTLWTNVENNVFPMG
IAAYHPMAQPGPGQSECLAMKIENPCTNSDCEGMCILSKDNGGFGVGYKCACPIGQKLVN
GKRCIDSIDYLLFSSNKIVRGIFPEMNEKALSEAVLPISPISQRRIGMYFEVECDVHGNS
FFYADIMDNTIYRIRPDGEGAAPVLVTHNDGLFSMSFDWISKQLYYVDNIRNSLEVVKIG
ETGLVHPDELVRRQLLTELRDPVSVVVHPWKGLLFYAEAMRPAAIYKCHIDGTNCEVIRN
TTLGRPSEMAIDFAENRLCWGDTLLKTISCMDFDGKNVVKVDAENPIPVAIAIMNEYIYY
VHQRPYSIRRVHKKNGGGSKVIREFGADERSIFSLKACSHQNQPIPDVSREHPCRASQCT
QLCFATPSESNPNELEAKCACRQGFKINKDNNHSCQKDPSEQIEQLCTSNSTQFQCKNGR
CIPKEWKCDGENDCLDESDEVDEKGDKCFHETECAENTIKCRNTKKCIPAQYGCDGDNDC
GDYSDEDVQYCKDGQKPVCAAKKFQCDNHRCIPEQWKCDSDNDCGDGSDEKLELCGNATC
AANQFSCANGRCIPIYWLCDGDNDCYDGTDEDKERCPPVQCSALQFRCASGRQCVPLRNH
CDGQNDCEDGSDEDSCAVNNDACTADQFKCASSGLCIPLSWKCDGQQDCDDGSDEPKFGC
TNSRQCKSDQFKCGNGRCILNNWLCDGENDCGDGSDESAERGCKAPLNARKCPFEHVACE
NDPEMCIPLHQLCDGKRHCPGGTDEGGRCARDLCSADRAGCSFKCHNSPNGPICSCPFGE
QVGTGNTCLLELIFCKKSLNKIYNLMIFTKLFIPTFFAFQLVNKTKCEPENECLDPSSCS
QLCTDEKHGFTCSCEEGYELDADKKTCKVESNVKDTRIYVSNRNRIYYSDHKLDNWHTFG
AVVENAIALAWDSLTDRIYWSDIREKKILSANRNGSDATVFIADGLDITEGIALDWVGRN
LYWVDSSLNTIEVANLEDPRHRTLLVHQNISQPRGIAVDPRQGVMFWTDWGQNPCIERAS
MDGTDRQIIVKTKIYWPNTIALDYTTNRVYFADSKLDFIDFVNYDGSGRTQVLSSSKFVQ
HPHALAIFEDMMYYSDRRLQKLQVYPKYPNGTTTEYPSHTFSKALGVVAVHPVLQPVVKE
NPCAKNTCSHLCLITNKKSFTCMCPMGKKIDSSGRKCIDDVKPFLVLIQKTNVFGVEMNA
ASVNATPLLSGMVPLAGLGNAFDAVYDALSAEMFILEHTNHAKTIAQITTDSAIYRSTIN
GGNRTKMFSSAVPDDAYCLGFDWNGRNLVVGNKITQTIELVRTQGDKQYRSVILSNDQSP
TAVVTPVSIAVDADKGYVFWLDRGGGASDAKVARAGLDGSNPLVIASNDLAELDHIALDT
TNQRVYFSEAKAGRISSVTYDGQDRHYVLNDGGRQPNGVAFHGDRLFYSDSAFDSIEVAT
INGDSQPPQWNHFKKDVENLANIKVLQPRASSSSHPCHISNGNCEHICIPQMFAQHTCAC
ANGYVKDGQTSCKLYDESFVIVATKTKVVGYPIDESQAKGVAMEPIGGISITSVDYDVES
KTIYVAEASGINKGITAYTIGESSPRAVIRDTIGSLTIKSVAVDWINYNMYFINHDAERT
NIEVAKLDGTYRKILLTTKTETPSSIAVDPVGRYLYWADQGQKPSIQRAFLDGSRREVIV
SSGIGEPTDLVVDVASRMIYWSDAKMDGIYRVRSTGGTPELVRTDIASAAGVALHGQNMY
WTDNRLEKLFRATSKPNQTSLLLSPTTVAAALKDIGEVSVFSSTNQPRANSPCQVTDNLR
KSPCTQLCFAAPATQTPTCACARGILKGRTCEEPDTYLMFTDGDKIIDAPIEPDVKASRP
LKEAFPEISNLQTFDVDVNLRRIYYVVESPVGANISWFSMNNADNPRLVFGASKQEHAKD
VRHISDMRLDWLTQKIYFTTGRGGKVMAIDTAGEHLSTIASGDWTYAIAIDPCSGLLFWS
DSGYKTSGGLYEPRIERSNLAGGSRKIIVSESISLPAAIAVDFRNQMIYWADVNRLNIEM
ADYNGQNRKVIASGYRAKSLDLWDRWLYMSDPLSNGVFRVDKESGSGLENVVSDRRIPGA
LRVFASESDVRTRNQVCNALTSQLCKTDNGGCDQLCTVIAEDVGLAASKVQCSCNDTYEL
VQEPGKDYPTQCVLRGSSAEPAKECLPPYNFQCGDGSCILLGATCDSKPDCPDASDENPN
YCNTRACPDGYHLCTNRRCIDSAKKCNHIDDCGDGSDELDCPSAVSCALGTFPCSNGHCI
NQTKVCDGHNDCHDEQVSDESLATCPGLPIDCRGVKIRCPNTNICIQPADLCDGYDDCGD
KADENQLFCMNQQCAQHYVRCPSGRCIPETWQCDGDNDCSDGWDETHTNCTDSAGKKICV
GEYLFQCDNLKCISRAFICDGEDDCGDGSDEHTRHGCGNRTCTDQEFHCASNAKLAQPKY
ECIPRAWLCDGDVTCAGGEDESTDLCKTEKKECNKGEFRCNNQHCIHSSWECDGDNDCLD
GSDEHANCTYSSCQPDFWQCANHKCVPNSWRCDGNDDCEDGSDEKECPKDSPAAQKASKC
ANGLYQCTSGECIDDSKVCDRNYDCSDRSDESSLCFIDECALAEKPLCEQKCIDQKIGYK
CDCFEGFAIDVSDQKSCHNVNECFEGISGCSQKCDDKIGSYKCACVEGYLLSSDDHSCKR
TEMEPEPFFLLANKHYIRKISMDGNKYEMAAQGFDNVVSLDIDLTEKKAYLIDQGKLRLL
RVNLDEMDSPLASYETVLRHNVYGTEGIAVDWVGRKLYMLNRQERSLRVCELDGRFCKTL
IRDRIQQPKAIAVHPGKGYLFFTEWSLQPYIGRMALDGSPELQDPIFKLAEHDLGWPNAI
AIDYFSDRLFWGDAHLNEIGFMDFDGNGRRHIPAQRTSHVSSMVVFDDYLYWADWNLREV
LRCDKWTGKNETVLKKTVQLPNDLRIVHPMRQPAYPNPCGDNNGGCTHLCLIGAGGNGFT
CSCPDQFVLLPDQKTCEPNCTERQFACGGEDAKCIPKLWYCDGEPDCRDGSDEPGESICG
QRICPVGEFQCANHNCTRPFQICDGNDDCGDGTDEQNCDKACDPWMFKCAVTGRCIPRRF
TCDGDDDCGDRSDEADGICMSPDRNCTAEEFRCNNNKCIAKAWRCDNDDDCGDGSDETPE
CAQIECKKGWTRCSSSYRCIPNWAFCNGQDDCRDNSDEDKQRCPSCDDVGEFRCATSGKC
IPKRWMCDTENDCGDNSDELDPSCGGTSRPCSESEFRCNDGKCIPGSKVCDGTIQCSDGL
DESQCTLRRCLPGHRQCDDGTCIAEHKWCDRKKDCPNAADELHCEDSSRRQCSPFEFECA
NSVCIPRKFMCDGDNDCGDNSDETSSECRSAQCDPPLRFRCAHSRLCLNILQLCNGFNDC
GPNDFSDEHLSMCSSFSEYGDCASDQFKCANGKCVNGTVACDRKDDCGDASDEIGCSKHG
GKTSCEAFGNNGGCKHICTDVRDGFYCHCRDGFRPDPSNPKDCIDIDECAGNNTCTQLCL
NTKGSYLCRCHEDYENNVVVGSMTGKDCRAKGDAANVMIGADASLVQLSLHGSGTNRHAA
AKANDEDNDIIGVAFDPRKDLMYWIDGSEKTIYRSAIASGNQSHEGQKLDLDFAGMGVVP
TAIAVDYSTGNLFIAAVAEGIESELAPARKKRMSEPVDNQNTGFIFVSLPDGRYLRKIVA
GHLQQPTALVTAPSAGRICYSDAGLHAKIECADMDGTHRQIIVKDLVFSPTSMAIDEGKS
NRIYWVDPKYRRIDSVNVDGTDRTTVVHDRHIPYAVDVFENHIYWLSRETKTLYVQDKFG
RGRVSVLASDLEDGHTVRVSQKYAKDTQRIASGCERAQCSHLCVSLPASGFACLCPEGIT
PQIDGSCATQHVEALTMPKQCSCTNGGKCKLDGTCECSSDFEGDGCENESSVSRKLIGRL
SENFFSVLLYILAFLAAFGLIGFIGLNVYKKRQLIFKKNEAADGSVSFHGNVISFSNPVL
ESKQDAPGSEFGMQQMASIHEDSTTFTNPVYELEDVDMSSPRQASDQPSTSAGPSTSSQP
SSSSFASPTFEQDEVEVKLGEELIAPKAEISKPPPIPARPNKKEPLRVDNPLYDPDSEVS
DV
Download sequence
Identical sequences CJA00448 281687.CJA00448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]