SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA03901 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA03901
Domain Number 1 Region: 175-589
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.34e-123
Family Reverse transcriptase 0.0000332
Further Details:      
 
Domain Number 2 Region: 785-924
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.05e-31
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA03901   Protein: JA23947   Gene: WBGene00123105
Sequence length 924
Comment JA23947 WBGene00123105 status:Predicted
Sequence
MAAQVRVRLLQRPVPYRRSNPPDGKPAGKGLPSRQLQVIPRRKYHVSSRVRTTHEGTLNK
KLTNHDMVVHQQSDLCDRLGLSITPTVFRSQNALLLVTNPTRTDITVPARATIANVGRVL
TAPDGSLHCSDTASDEAFPNIATTDSRLQPLDPDFKIDFNSIQCKEEERRQLGQLCEDYA
DVLSRNPYDLGSSKTDPVHIYTTSEVPVKSRPYRVPVKYQAELEQHINALIRSERITESN
TPWTSPIVLVKKKSGALRVCLDFRRLNDITIPDNFPLPRIDAILEKVGGARYFSSLDMAN
GYLQLRLDAESSYKCGFITETKVFAYTHLPFELKSAASYFQRALKTVLANMDRDVLVYID
DILIYSQDFGQHIATLRNVLDRFRQFNLKVSPKKCEFLKKAITFLGHTITESNYTPNEAN
VKSIAEMSTPKNLAEIRRFVGMVGFFRKFLPNLATVAEPLTRLNRKNEKFRWETPQQEAF
DTLRKALLNKPILAFPDYEKPFHLFCDAPAVGLGAALMQAETEEEKHFKVELLAIIFALR
HFRPYICLSKIILHSDHRPLSYLLSKHKVNDNLARWLIELQQYDIKIVHIDGKKNTVADY
LSRIQGESQPKEAELEDIVSFPICMANTTYEHVPPTVLKISGMNSIDINEEQRKDPVLVS
VRALIEKRPTPCIDLPSEWKHYLKFVKISTRGTLIINFPGTPGLAEDTTIVPEALRELVI
TGHHASLLGGGHFHWRPTMHKTQKKFFWPGMRTSIIQHCLRCQQFQLRRSKPPAQREQQL
VVPTNYVFQRVGIDLTGPLPVTAQRNRYYMNAICWFTRYVISIPLPDTRADTCARALLNH
VVLKYGAMSELISDGASGFTSTAFEHFCALLEIQHHTAIPHHSRGNGATERTFRTFHNSM
AKYVNNKHNDWEDHLQAVAFAYNT
Download sequence
Identical sequences CJA03901 281687.CJA03901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]