SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA03913 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA03913
Domain Number 1 Region: 3-203
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-24
Family Calponin-homology domain, CH-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA03913   Protein: JA37081   Gene: WBGene00123117
Sequence length 355
Comment JA37081 WBGene00123117 status:Predicted
Sequence
MLLTGKGALHRHFLLITMKLMFLIETAHSQKIISNLTRIFTKSSCFKCLDDMASDLTKEM
LSGSSASLKKAFAKIGFTPSYKQSFVENYDYEAKGFEDFSDGLILAKLIETIGEMEHGQL
LLKLRDPAGDRIRKINNVKTVFAAMNEMGISTENATPACVVGGKKEAILSILWALIGVRV
AKEKKIRIPRTVDKTPKLYDVVCQVLSNRQSIGSSERSLSPCSTIQNGTFTISQFSDRQS
IDITLNDATFTVSRESVDSVGGFKMPKTPTRVTFSRTTISNTIDQVIEEEEEDEDGESTI
VPSTARKRNVVSVEHKVFETFEESSELEEKEEEKEEEQRDENQDPDIQGISHQAV
Download sequence
Identical sequences 281687.CJA03913 CJA03913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]