SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA04053 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA04053
Domain Number 1 Region: 513-707
Classification Level Classification E-value
Superfamily Sec7 domain 7.33e-73
Family Sec7 domain 0.00000213
Further Details:      
 
Domain Number 2 Region: 103-247,354-486,823-1221
Classification Level Classification E-value
Superfamily ARM repeat 6.37e-19
Family HEAT repeat 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA04053   Protein: JA37758   Gene: WBGene00123257
Sequence length 1467
Comment JA37758 WBGene00123257 locus:Cjp-agef-1 status:Predicted
Sequence
MVEKSRKTIGNMFLKSGIEKILADRDIKRKENLQLKKACESALGEFYFFCWKILNKFSMN
FSEQLKASESNDGLSAPASTNGEHLPDAGIAVEADRYFLPFELACNSKSPKIVITALDCL
QKLIAYGHLTGKGADISNPDRKLIDRIVEAICAPFLGQGTDETVLLQLIKAVLAVVLSNH
CEVHGASLILAVRTCFNIYLTSKSPINQATAKGTLTQVINTVFAKMEKYGNIKDDETIVK
EVVESLISTTASQELTDEKSEGGGTRKNGSTIGETEEDQFTFVNAYQKDAFLVFRALCIL
AQKEEGDANDMSLRSKLLALEMLLLVLQNSSSVLQNSQPCVIVIKRTLCVALSRNAVSSN
VQVLEKSLAIFVELLDKFKAHLKMQIEVFFTEIILPMLARGLFERRWIVLNTIGKILANP
QSVVDMFVNYDCDMTSHNLFNSIVEVVSKKMEINESAPPAQKEKERAMRLLGLSCLTDLL
QCLVDWFQVCEVAKIATLDIPDAEVHEKEETYEKFENLKQQKNLMEQGIRIFAEKPKKGL
KFLQDHGFVGTDAVDVADFLMKEERLNKTQVGDFLGDSDEFNISVMHAYIDFLEFSNLDI
LAALRLFLEKFRLPGEAQKIDRLMLKFASRYMDCNPRQGIFASADAAYVLAFSIIMLTTD
LHNKTVKKKMTPEDYIKMNRGINDGGDFTPELLGAIYEDISKNEIKMRAGDTDLLRNRMS
LGQGALTTDKEKRAMAMLEMEAMSKTARQTCKAHFRCLRIFRLSNFFIDFIIFLSIKPVF
LYVLKATGTLDEKTLHTLQDALGETSSQSVVVAIDRIFNGSARLSAEAIVHFVTALCTVS
REELLHPSAPRMFLLGKVVEVAFYNMNRIRLEWSRIWHVIGEHFNAAGCDANENVAYFSV
DALRQLSIKFLEKGELPNFKFQKDFLRPFEVIMKKNGSAATRDLVVRCCTHLVESHSSRL
KSGWQNLFAVWMLAASDPSVEIAETSFLTAQHVIETRFKDDFPSILDSFNEALKCLQEFA
CNPNLPDLNMEAIRLIRLCADYISKNRDRFDEAARDASHGLSADQHVWIQGWFPLFFGLS
CIINRCKLDVRTRSLTVMFEIMKYHGEDFRPEWWKELFDIVFRIFDPSKMDDHRSDKREW
MSTTCNHAMVSVVDVFTQFYTILAGIALPMIYKQFGVFIRQQNEQLARCTISCLETLISN
NGERFTESMWQDTIELIRELFAATLPKSLLSWQPPNHSHNGVISEESSSSASDALFTEQI
VFCVVQNELVEAVSRIVLGDGKCKIDGLFAEMSPQLLLSICAALAESHKLAKQFNDNNGQ
RTLLWKAGLRGSSKPNLINQETRSLSAMLAIILRLLYDPRAQEKTISDEIAVRVLEVVSL
ALNGYGQAESESRRTAYGPVICELLRECIDLPVELLPVLGPEFPLKLCDLVETAEGQSLR
KLLADLLRRLMTIGSPHVSRQDEQEIA
Download sequence
Identical sequences 281687.CJA04053 CJA04053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]